SCOPe 2.07: Domain d1q78a2: 1q78 A:19-214

Lineage for d1q78a2 (1q78 A:19-214)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.3: Poly(A) polymerase, PAP, N-terminal domain [81589] (1 protein)
   insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543

6. Protein Poly(A) polymerase, PAP, N-terminal domain [81588] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81587] (3 PDB entries)
   Uniprot P25500 18-497

8. Domain d1q78a2: 1q78 A:19-214 [104546]
   Other proteins in same PDB: d1q78a1, d1q78a3
   protein/RNA complex; complexed with 3at, mg

Details for d1q78a2

PDB Entry: 1q78, 2.8 Å

PDB Description: Crystal structure of poly(A) polymerase in complex with 3'-dATP and magnesium chloride

PDB Compounds: (A:) Poly(A) polymerase alpha

SCOPe Domain Sequences for d1q78a2:

Sequence; same for both SEQRES and ATOM records:

>d1q78a2 d.218.1.3 (A:19-214) Poly(A) polymerase, PAP, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
hygitspislaapketdclltqklvetlkpfgvfeeeeelqrrililgklnnlvkewire
isesknlpqsvienvggkiftfgsyrlgvhtkgadidalcvaprhvdrsdfftsfydklk
lqeevkdlraveeafvpviklcfdgieidilfarlalqtipedldlrddsllknldirci
rslngcrvtdeilhlv

Timeline for d1q78a2:

• d1q78a2 first appeared in SCOP 1.69
  
• d1q78a2 appears in SCOPe 2.06
  
• d1q78a2 appears in the current release, SCOPe 2.08