Lineage for d1q39a2 (1q39 A:4-124)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 965893Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 965894Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) (S)
  5. 965895Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins)
  6. 965924Protein Endonuclease VIII [82233] (1 species)
  7. 965925Species Escherichia coli [TaxId:562] [82234] (8 PDB entries)
    Uniprot P50465
  8. 965932Domain d1q39a2: 1q39 A:4-124 [104516]
    Other proteins in same PDB: d1q39a1, d1q39a3
    complexed with ca, zn

Details for d1q39a2

PDB Entry: 1q39 (more details), 2.8 Å

PDB Description: Crystal structure of the DNA repair enzyme endonuclease-VIII (Nei) from E. coli: The WT enzyme at 2.8 resolution.
PDB Compounds: (A:) Endonuclease VIII

SCOPe Domain Sequences for d1q39a2:

Sequence, based on SEQRES records: (download)

>d1q39a2 b.113.1.1 (A:4-124) Endonuclease VIII {Escherichia coli [TaxId: 562]}
peirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsndlt
lyshnqlygvwrvvdtgeepqttrvlrvklqtadktillysasdiemlrpeqltthpflq
r

Sequence, based on observed residues (ATOM records): (download)

>d1q39a2 b.113.1.1 (A:4-124) Endonuclease VIII {Escherichia coli [TaxId: 562]}
peirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsndlt
lyshnqlygvwrvvdtgeettrvlrvklqtadktillysasdiemlrpeqltthpflqr

SCOPe Domain Coordinates for d1q39a2:

Click to download the PDB-style file with coordinates for d1q39a2.
(The format of our PDB-style files is described here.)

Timeline for d1q39a2: