Lineage for d1q25a1 (1q25 A:7-129)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807135Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
    barrel, partly open; n*=8, S*=10; one psi loop
  4. 2807136Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) (S)
  5. 2807137Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins)
  6. 2807166Protein Cation-independent mannose-6-phosphate receptor (MIR-receptor) [63821] (3 species)
  7. 2807169Species Cow (Bos taurus) [TaxId:9913] [110283] (5 PDB entries)
    Uniprot P08169 49-476
  8. 2807170Domain d1q25a1: 1q25 A:7-129 [104493]
    complexed with gol

Details for d1q25a1

PDB Entry: 1q25 (more details), 1.8 Å

PDB Description: crystal structure of n-terminal 3 domains of ci-mpr
PDB Compounds: (A:) Cation-Independent Mannose 6-phosphate receptor

SCOPe Domain Sequences for d1q25a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q25a1 b.64.1.1 (A:7-129) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Cow (Bos taurus) [TaxId: 9913]}
aefpelcsytweavdtknnmlykinicgnmgvaqcgpssavcmhdlktdsfhsvgdsllk
tasrsllefnttvnckqqnhkiqssitflcgktlgtpefvtatdcvhyfewrttaackkn
ifk

SCOPe Domain Coordinates for d1q25a1:

Click to download the PDB-style file with coordinates for d1q25a1.
(The format of our PDB-style files is described here.)

Timeline for d1q25a1: