PDB entry 1q25

View 1q25 on RCSB PDB site
Description: Crystal structure of N-terminal 3 domains of CI-MPR
Class: protein transport,sugar binding protein
Keywords: P-lectin, receptor, mannose 6-phosphate, PROTEIN TRANSPORT, SUGAR BINDING PROTEIN
Deposited on 2003-07-23, released 2004-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cation-Independent Mannose 6-phosphate receptor
    Species: Bos taurus [TaxId:9913]
    Gene: IGF2R
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q25a1, d1q25a2, d1q25a3
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q25A (A:)
    aagtqgaefpelcsytweavdtknnmlykinicgnmgvaqcgpssavcmhdlktdsfhsv
    gdsllktasrsllefnttvnckqqnhkiqssitflcgktlgtpefvtatdcvhyfewrtt
    aackknifkankevpcyafdrelkkhdlnpliktsgaylvddsdpdtslfinvcrdievl
    rasspqvrvcptgaaaclvrgdrafdvgrpqeglklvsndrlvlsyvkegagqpdfcdgh
    spavtitfvcpserregtipkltaksncrfeiewvteyachrdylesrscslssaqhdva
    vdlqplsrveasdslfytseadeytyylsicggsqapicnkkdaavcqvkkadstqvkva
    grpqnltlrysdgdltliyfggeecssgfqrmsvinfecnqtagnngrgapvftgevdct
    yfftwdtkyacv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q25A (A:)
    qgaefpelcsytweavdtknnmlykinicgnmgvaqcgpssavcmhdlktdsfhsvgdsl
    lktasrsllefnttvnckqqnhkiqssitflcgktlgtpefvtatdcvhyfewrttaack
    knifkankevpcyafdrelkkhdlnpliktsgaylvddsdpdtslfinvcrdievlrass
    pqvrvcptgaaaclvrgdrafdvgrpqeglklvsndrlvlsyvkegagqpdfcdghspav
    titfvcpserregtipkltaksncrfeiewvteyachrdylesrscslssaqhdvavdlq
    plsrveasdslfytseadeytyylsicggsqapicnkkdaavcqvkkadstqvkvagrpq
    nltlrysdgdltliyfggeecssgfqrmsvinfecnqtagnngrgapvftgevdctyfft
    wdtkyacv