Lineage for d1q23a_ (1q23 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874558Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2874559Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2874560Family c.43.1.1: CAT-like [52778] (3 proteins)
    trimeric enzymes with the active sites being located in between subunits
  6. 2874561Protein Chloramphenicol acetyltransferase, CAT [52779] (2 species)
  7. 2874562Species Escherichia coli [TaxId:562] [52780] (10 PDB entries)
    Uniprot P00483
  8. 2874571Domain d1q23a_: 1q23 A: [104481]
    complexed with ca, fua

Details for d1q23a_

PDB Entry: 1q23 (more details), 2.18 Å

PDB Description: Crystal structure of Chloramphenicol acetyltransferase I complexed with Fusidic acid at 2.18 A resolution
PDB Compounds: (A:) Chloramphenicol acetyltransferase

SCOPe Domain Sequences for d1q23a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]}
itgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihila
rlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdv
acygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvl
mplaiqvhhavcdgfhvgrmlnelqqycdewqgg

SCOPe Domain Coordinates for d1q23a_:

Click to download the PDB-style file with coordinates for d1q23a_.
(The format of our PDB-style files is described here.)

Timeline for d1q23a_: