PDB entry 1q23

View 1q23 on RCSB PDB site
Description: Crystal structure of Chloramphenicol acetyltransferase I complexed with Fusidic acid at 2.18 A resolution
Class: transferase
Keywords: CAT I, trimer, Fusidic acid, TRANSFERASE
Deposited on 2003-07-23, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.195
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q23a_
  • Chain 'B':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q23b_
  • Chain 'C':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q23c_
  • Chain 'D':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q23d_
  • Chain 'E':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q23e_
  • Chain 'F':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q23f_
  • Chain 'G':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q23g_
  • Chain 'H':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q23h_
  • Chain 'I':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q23i_
  • Chain 'J':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q23j_
  • Chain 'K':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q23k_
  • Chain 'L':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q23l_
  • Heterogens: CA, FUA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q23A (A:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q23A (A:)
    itgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihila
    rlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdv
    acygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvl
    mplaiqvhhavcdgfhvgrmlnelqqycdewqgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q23B (B:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q23B (B:)
    ekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafih
    ilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiys
    qdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgd
    kvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q23C (C:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q23C (C:)
    tgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihilar
    lmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdva
    cygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvlm
    plaiqvhhavcdgfhvgrmlnelqqycdewqgg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q23D (D:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q23D (D:)
    tgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihilar
    lmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdva
    cygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvlm
    plaiqvhhavcdgfhvgrmlnelqqycdewqgg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1q23E (E:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q23E (E:)
    kkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihi
    larlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysq
    dvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdk
    vlmplaiqvhhavcdgfhvgrmlnelqqycdewqg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1q23F (F:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q23F (F:)
    tgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihilar
    lmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdva
    cygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvlm
    plaiqvhhavcdgfhvgrmlnelqqycdewqg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1q23G (G:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q23G (G:)
    tgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihilar
    lmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdva
    cygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvlm
    plaiqvhhavcdgfhvgrmlnelqqycdewqgg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1q23H (H:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q23H (H:)
    kitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihil
    arlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqd
    vacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkv
    lmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1q23I (I:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q23I (I:)
    kkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihi
    larlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysq
    dvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdk
    vlmplaiqvhhavcdgfhvgrmlnelqqycdewqg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1q23J (J:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q23J (J:)
    itgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihila
    rlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdv
    acygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvl
    mplaiqvhhavcdgfhvgrmlnelqqycdewq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1q23K (K:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q23K (K:)
    kkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihi
    larlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysq
    dvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdk
    vlmplaiqvhhavcdgfhvgrmlnelqqycdew
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1q23L (L:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q23L (L:)
    tgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihilar
    lmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdva
    cygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvlm
    plaiqvhhavcdgfhvgrmlnelqqycdew