Lineage for d1q1ca1 (1q1c A:21-140)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857507Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 857508Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 857509Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)
  6. 857598Protein FKBP52, N-terminal domains [82619] (1 species)
  7. 857599Species Human (Homo sapiens) [TaxId:9606] [82620] (4 PDB entries)
    Uniprot Q02790 21-427; contains tandem repeat of two FKPB domains
  8. 857600Domain d1q1ca1: 1q1c A:21-140 [104474]

Details for d1q1ca1

PDB Entry: 1q1c (more details), 1.9 Å

PDB Description: Crystal structure of N(1-260) of human FKBP52
PDB Compounds: (A:) FK506-binding protein 4

SCOP Domain Sequences for d1q1ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
egvdispkqdegvlkvikregtgtempmigdrvfvhytgwlldgtkfdssldrkdkfsfd
lgkgevikawdiaiatmkvgevchitckpeyaygsagsppkippnatlvfevelfefkge

SCOP Domain Coordinates for d1q1ca1:

Click to download the PDB-style file with coordinates for d1q1ca1.
(The format of our PDB-style files is described here.)

Timeline for d1q1ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q1ca2