Lineage for d1q1ca1 (1q1c A:21-140)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies)
core: beta(2)-alpha-beta(2); antiparallel beta-sheetSuperfamily d.26.1: FKBP-like [54534] (4 families) 
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) 
Protein FKBP52, N-terminal domains [82619] (1 species) Species Human (Homo sapiens) [TaxId:9606] [82620] (11 PDB entries)
Uniprot Q02790 21-427; contains tandem repeat of two FKPB domains
Domain d1q1ca1: 1q1c A:21-140 [104474]
complexed with dms, edo
Details for d1q1ca1
PDB Entry: 1q1c (more details), 1.9 Å
PDB Description: Crystal structure of N(1-260) of human FKBP52
PDB Compounds: (A:) FK506-binding protein 4SCOPe Domain Sequences for d1q1ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
egvdispkqdegvlkvikregtgtempmigdrvfvhytgwlldgtkfdssldrkdkfsfd
lgkgevikawdiaiatmkvgevchitckpeyaygsagsppkippnatlvfevelfefkge
SCOPe Domain Coordinates for d1q1ca1:
Click to download the PDB-style file with coordinates for d1q1ca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1q1ca1:
- d1q1ca1 first appeared in SCOP 1.69
- d1q1ca1 appears in SCOPe 2.07
View in 3D
