Lineage for d1q0fl_ (1q0f L:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637916Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 638393Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family) (S)
  5. 638394Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (1 protein)
  6. 638395Protein Nickel-containing superoxide dismutase, NiSOD [109772] (2 species)
  7. 638415Species Streptomyces seoulensis [TaxId:73044] [109773] (5 PDB entries)
  8. 638445Domain d1q0fl_: 1q0f L: [104427]
    complexed with 3ni, so4

Details for d1q0fl_

PDB Entry: 1q0f (more details), 2.2 Å

PDB Description: Crystal structure of Ni-containing superoxide dismutase with Ni-ligation corresponding to the state after partial x-ray-induced reduction
PDB Compounds: (L:) Superoxide dismutase [Ni]

SCOP Domain Sequences for d1q0fl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0fl_ a.24.22.1 (L:) Nickel-containing superoxide dismutase, NiSOD {Streptomyces seoulensis [TaxId: 73044]}
hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka

SCOP Domain Coordinates for d1q0fl_:

Click to download the PDB-style file with coordinates for d1q0fl_.
(The format of our PDB-style files is described here.)

Timeline for d1q0fl_: