SCOPe 2.08: Domain d1pzma_: 1pzm A:

Lineage for d1pzma_ (1pzm A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Hypoxanthine-guanine-xanthine PRTase [53275] (3 species)

7. Species Leishmania tarentolae [TaxId:5689] [110658] (1 PDB entry)
   Uniprot Q9NJI5

8. Domain d1pzma_: 1pzm A: [104395]
   complexed with 5gp

Details for d1pzma_

PDB Entry: 1pzm, 2.1 Å

PDB Description: Crystal structure of HGPRT-ase from Leishmania tarentolae in complex with GMP

PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d1pzma_:

Sequence, based on SEQRES records:

>d1pzma_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Leishmania tarentolae [TaxId: 5689]}
ypmsartlvtqeqvwaatakcakkiaadykdfhltadnplyllcvlkgsfiftadlarfl
adegvpvkveficassygsgvetsgqvrmlldvrdsvenrhimlvedivdsaitlqylmr
fmlakkpaslktvvlldkpsgrkvdvlvdypvitiprafvigygmdfaesyrelrdicvl
kke

Sequence, based on observed residues (ATOM records):

>d1pzma_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Leishmania tarentolae [TaxId: 5689]}
ypmsartlvtqeqvwaatakcakkiaadykdfhltadnplyllcvlkgsfiftadlarfl
adegvpvkveficasmlldvrdsvenrhimlvedivdsaitlqylmrfmlakkpaslktv
vlldkpsgrkvdvlvdypvitiprafvigygmdfaesyrelrdicvlkke

Timeline for d1pzma_:

• d1pzma_ first appeared in SCOP 1.69
  
• d1pzma_ appears in SCOPe 2.07