Lineage for d1pzma_ (1pzm A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 489867Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 489868Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 489869Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (11 proteins)
  6. 489967Protein Hypoxanthine-guanine-xanthine PRTase [53275] (3 species)
  7. 489968Species Leishmania tarentolae [TaxId:5689] [110658] (1 PDB entry)
  8. 489969Domain d1pzma_: 1pzm A: [104395]

Details for d1pzma_

PDB Entry: 1pzm (more details), 2.1 Å

PDB Description: Crystal structure of HGPRT-ase from Leishmania tarentolae in complex with GMP

SCOP Domain Sequences for d1pzma_:

Sequence, based on SEQRES records: (download)

>d1pzma_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Leishmania tarentolae}
ypmsartlvtqeqvwaatakcakkiaadykdfhltadnplyllcvlkgsfiftadlarfl
adegvpvkveficassygsgvetsgqvrmlldvrdsvenrhimlvedivdsaitlqylmr
fmlakkpaslktvvlldkpsgrkvdvlvdypvitiprafvigygmdfaesyrelrdicvl
kke

Sequence, based on observed residues (ATOM records): (download)

>d1pzma_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Leishmania tarentolae}
ypmsartlvtqeqvwaatakcakkiaadykdfhltadnplyllcvlkgsfiftadlarfl
adegvpvkveficasmlldvrdsvenrhimlvedivdsaitlqylmrfmlakkpaslktv
vlldkpsgrkvdvlvdypvitiprafvigygmdfaesyrelrdicvlkke

SCOP Domain Coordinates for d1pzma_:

Click to download the PDB-style file with coordinates for d1pzma_.
(The format of our PDB-style files is described here.)

Timeline for d1pzma_: