SCOPe 2.05: Domain d1ppvb_: 1ppv B:

Lineage for d1ppvb_ (1ppv B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.2: IPP isomerase-like [64369] (4 proteins)

6. Protein Isopentenyl diphosphate isomerase [64370] (2 species)

7. Species Escherichia coli [TaxId:562] [64371] (15 PDB entries)
   Uniprot Q46822

8. Domain d1ppvb_: 1ppv B: [104283]
   complexed with bhi, mg, mn

Details for d1ppvb_

PDB Entry: 1ppv, 1.7 Å

PDB Description: isopentenylpyrophosphate-dimethylallylpyrophosphate isomerase in complex with the bromohydrine of ipp

PDB Compounds: (B:) Isopentenyl-diphosphate delta-isomerase

SCOPe Domain Sequences for d1ppvb_:

Sequence; same for both SEQRES and ATOM records:

>d1ppvb_ d.113.1.2 (B:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlkl

Timeline for d1ppvb_:

• d1ppvb_ first appeared in SCOP 1.69
  
• d1ppvb_ appears in SCOPe 2.04
  
• d1ppvb_ is called d1ppvb1 in SCOPe 2.06
  
• d1ppvb_ appears in the current release, SCOPe 2.08, called d1ppvb1