SCOP 1.75: Domain d1p8aa_: 1p8a A:

Lineage for d1p8aa_ (1p8a A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family)
   share the common active site structure with the family II

5. Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins)

6. Protein Tyrosine phosphatase [52790] (4 species)

7. Species Tritrichomonas foetus [TaxId:5724] [110595] (1 PDB entry)
   Uniprot O00810

8. Domain d1p8aa_: 1p8a A: [104084]
   mutant

Details for d1p8aa_

PDB Entry: 1p8a

PDB Description: solution structure of the low molecular weight protein tyrosine phosphatase from tritrichomonas foetus

PDB Compounds: (A:) protein tyrosine phosphatase

SCOP Domain Sequences for d1p8aa_:

Sequence; same for both SEQRES and ATOM records:

>d1p8aa_ c.44.1.1 (A:) Tyrosine phosphatase {Tritrichomonas foetus [TaxId: 5724]}
aaekkavlfvclgnicrspacegicrdmvgdkliidsaatsgfhvgqspdtrsqkvcksn
gvdiskqrarqitkadfskfdviaaldqsilsdinsmkpsncrakvvlfnppngvddpyy
ssdgfptmfasiskemkpfltehgli

Timeline for d1p8aa_:

• d1p8aa_ first appeared in SCOP 1.69
  
• d1p8aa_ appears in SCOP 1.73
  
• d1p8aa_ appears in SCOPe 2.01
  
• d1p8aa_ appears in the current release, SCOPe 2.08