![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) ![]() share the common active site structure with the family II |
![]() | Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins) |
![]() | Protein Tyrosine phosphatase [52790] (4 species) |
![]() | Species Tritrichomonas foetus [TaxId:5724] [110595] (1 PDB entry) |
![]() | Domain d1p8aa_: 1p8a A: [104084] |
PDB Entry: 1p8a (more details)
SCOP Domain Sequences for d1p8aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p8aa_ c.44.1.1 (A:) Tyrosine phosphatase {Tritrichomonas foetus} aaekkavlfvclgnicrspacegicrdmvgdkliidsaatsgfhvgqspdtrsqkvcksn gvdiskqrarqitkadfskfdviaaldqsilsdinsmkpsncrakvvlfnppngvddpyy ssdgfptmfasiskemkpfltehgli
Timeline for d1p8aa_: