Lineage for d1p8aa_ (1p8a A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486195Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 486196Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) (S)
    share the common active site structure with the family II
  5. 486197Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins)
  6. 486213Protein Tyrosine phosphatase [52790] (4 species)
  7. 486230Species Tritrichomonas foetus [TaxId:5724] [110595] (1 PDB entry)
  8. 486231Domain d1p8aa_: 1p8a A: [104084]

Details for d1p8aa_

PDB Entry: 1p8a (more details)

PDB Description: solution structure of the low molecular weight protein tyrosine phosphatase from tritrichomonas foetus

SCOP Domain Sequences for d1p8aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8aa_ c.44.1.1 (A:) Tyrosine phosphatase {Tritrichomonas foetus}
aaekkavlfvclgnicrspacegicrdmvgdkliidsaatsgfhvgqspdtrsqkvcksn
gvdiskqrarqitkadfskfdviaaldqsilsdinsmkpsncrakvvlfnppngvddpyy
ssdgfptmfasiskemkpfltehgli

SCOP Domain Coordinates for d1p8aa_:

Click to download the PDB-style file with coordinates for d1p8aa_.
(The format of our PDB-style files is described here.)

Timeline for d1p8aa_: