Lineage for d1ou6d1 (1ou6 D:1-268)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 593921Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 593922Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 593923Family c.95.1.1: Thiolase-related [53902] (8 proteins)
  6. 594082Protein Biosynthetic thiolase [53905] (1 species)
  7. 594083Species Zoogloea ramigera [TaxId:350] [53906] (12 PDB entries)
  8. 594114Domain d1ou6d1: 1ou6 D:1-268 [104031]

Details for d1ou6d1

PDB Entry: 1ou6 (more details), 2.07 Å

PDB Description: Biosynthetic thiolase from Zoogloea ramigera in complex with acetyl-O-pantetheine-11-pivalate

SCOP Domain Sequences for d1ou6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ou6d1 c.95.1.1 (D:1-268) Biosynthetic thiolase {Zoogloea ramigera}
stpsiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpa
gegqnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesms
maphcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafav
asqnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegt
vtagnasglndgaaaallmseaeasrrg

SCOP Domain Coordinates for d1ou6d1:

Click to download the PDB-style file with coordinates for d1ou6d1.
(The format of our PDB-style files is described here.)

Timeline for d1ou6d1: