Lineage for d1ojhj_ (1ojh J:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450651Fold a.214: NblA-like (Pfam 04485) [109858] (1 superfamily)
    4 helices; dimer of identical alpha-hairpin subunits; open bundle
  4. 450652Superfamily a.214.1: NblA-like (Pfam 04485) [109859] (1 family) (S)
  5. 450653Family a.214.1.1: NblA-like (Pfam 04485) [109860] (1 protein)
  6. 450654Protein Phycobilisome degradation protein NblA [109861] (1 species)
  7. 450655Species Anabaena sp. strain PCC 7120 [109862] (1 PDB entry)
  8. 450665Domain d1ojhj_: 1ojh J: [103985]

Details for d1ojhj_

PDB Entry: 1ojh (more details), 1.8 Å

PDB Description: crystal structure of nbla from pcc 7120

SCOP Domain Sequences for d1ojhj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojhj_ a.214.1.1 (J:) Phycobilisome degradation protein NblA {Anabaena sp. strain PCC 7120}
lsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqwg

SCOP Domain Coordinates for d1ojhj_:

Click to download the PDB-style file with coordinates for d1ojhj_.
(The format of our PDB-style files is described here.)

Timeline for d1ojhj_: