PDB entry 1ojh

View 1ojh on RCSB PDB site
Description: crystal structure of nbla from pcc 7120
Deposited on 2003-07-10, released 2004-07-15
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-15, with a file datestamp of 2004-07-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18412
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ojha_
  • Chain 'B':
    Domains in SCOP 1.69: d1ojhb_
  • Chain 'C':
    Domains in SCOP 1.69: d1ojhc_
  • Chain 'D':
    Domains in SCOP 1.69: d1ojhd_
  • Chain 'E':
    Domains in SCOP 1.69: d1ojhe_
  • Chain 'F':
    Domains in SCOP 1.69: d1ojhf_
  • Chain 'G':
    Domains in SCOP 1.69: d1ojhg_
  • Chain 'H':
    Domains in SCOP 1.69: d1ojhh_
  • Chain 'I':
    Domains in SCOP 1.69: d1ojhi_
  • Chain 'J':
    Domains in SCOP 1.69: d1ojhj_
  • Chain 'K':
    Domains in SCOP 1.69: d1ojhk_
  • Chain 'L':
    Domains in SCOP 1.69: d1ojhl_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ojhA (A:)
    mnqpielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqwglds
    gstpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojhA (A:)
    ielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ojhB (B:)
    mnqpielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqwglds
    gstpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojhB (B:)
    ielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ojhC (C:)
    mnqpielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqwglds
    gstpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojhC (C:)
    elsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqwgl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ojhD (D:)
    mnqpielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqwglds
    gstpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojhD (D:)
    nqpielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqwg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ojhE (E:)
    mnqpielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqwglds
    gstpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojhE (E:)
    ielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ojhF (F:)
    mnqpielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqwglds
    gstpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojhF (F:)
    ielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ojhG (G:)
    mnqpielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqwglds
    gstpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojhG (G:)
    pielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ojhH (H:)
    mnqpielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqwglds
    gstpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojhH (H:)
    ielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkh
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1ojhI (I:)
    mnqpielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqwglds
    gstpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojhI (I:)
    pielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqwg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1ojhJ (J:)
    mnqpielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqwglds
    gstpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojhJ (J:)
    lsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqwg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1ojhK (K:)
    mnqpielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqwglds
    gstpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojhK (K:)
    lsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqw
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ojhL (L:)
    mnqpielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqwglds
    gstpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojhL (L:)
    ielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkh