Lineage for d1o5ta_ (1o5t A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 984755Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 984756Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 984757Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 984851Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (4 species)
    overall structure is similar to TyrRS
  7. 984901Species Human (Homo sapiens) [TaxId:9606] [102256] (11 PDB entries)
    Uniprot P23381 94-471
  8. 984914Domain d1o5ta_: 1o5t A: [103891]

Details for d1o5ta_

PDB Entry: 1o5t (more details), 2.5 Å

PDB Description: Crystal structure of the aminoacylation catalytic fragment of human tryptophanyl-tRNA synthetase
PDB Compounds: (A:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d1o5ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5ta_ c.26.1.1 (A:) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]}
sakgidydklivrfgsskidkelinrieratgqrphhflrrgiffshrdmnqvldayenk
kpfylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekylwkdltldqays
yavenakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnqvkgifgftdsd
cigkisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtrdvaprigypkpa
llhstffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggrdtieehrqfggn
cdvdvsfmyltffledddkleqirkdytsgamltgelkkalievlqpliaehqarrkevt
deivkefmtprklsfdfq

SCOPe Domain Coordinates for d1o5ta_:

Click to download the PDB-style file with coordinates for d1o5ta_.
(The format of our PDB-style files is described here.)

Timeline for d1o5ta_: