Lineage for d1nonb_ (1non B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 838986Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 838987Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 838988Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins)
  6. 839169Protein Pyrimidine operon regulator PyrR [109612] (4 species)
    bifunctional protein; contains the uracil PRTase and Pyr RNA-binding activities
  7. 839170Species Bacillus caldolyticus [TaxId:1394] [110659] (4 PDB entries)
    Uniprot P41007
  8. 839176Domain d1nonb_: 1non B: [103869]

Details for d1nonb_

PDB Entry: 1non (more details), 2.4 Å

PDB Description: PyrR, the regulator of the pyrimidine biosynthetic operon in Bacillus caldolyticus
PDB Compounds: (B:) PyrR bifunctional protein

SCOP Domain Sequences for d1nonb_:

Sequence, based on SEQRES records: (download)

>d1nonb_ c.61.1.1 (B:) Pyrimidine operon regulator PyrR {Bacillus caldolyticus [TaxId: 1394]}
mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
vpvgelditlyrddltvktddheplvkgtnvpfpvternvilvddvlftgrtvraamdav
mdlgrpariqlavlvdrghrelpiradfvgknvptsrselivvelsevdgidqvsihek

Sequence, based on observed residues (ATOM records): (download)

>d1nonb_ c.61.1.1 (B:) Pyrimidine operon regulator PyrR {Bacillus caldolyticus [TaxId: 1394]}
mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
vpvgelditlyrvpfpvternvilvddvlftgrtvraamdavmdlgrpariqlavlvdrg
hrelpiradfvgknvptsrselivvelsevdgidqvsihek

SCOP Domain Coordinates for d1nonb_:

Click to download the PDB-style file with coordinates for d1nonb_.
(The format of our PDB-style files is described here.)

Timeline for d1nonb_: