Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (2 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins) |
Protein Pyrimidine operon regulator PyrR [109612] (4 species) bifunctional protein; contains the uracil PRTase and Pyr RNA-binding activities |
Species Bacillus caldolyticus [TaxId:1394] [110659] (4 PDB entries) Uniprot P41007 |
Domain d1nonb_: 1non B: [103869] |
PDB Entry: 1non (more details), 2.4 Å
SCOP Domain Sequences for d1nonb_:
Sequence, based on SEQRES records: (download)
>d1nonb_ c.61.1.1 (B:) Pyrimidine operon regulator PyrR {Bacillus caldolyticus [TaxId: 1394]} mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas vpvgelditlyrddltvktddheplvkgtnvpfpvternvilvddvlftgrtvraamdav mdlgrpariqlavlvdrghrelpiradfvgknvptsrselivvelsevdgidqvsihek
>d1nonb_ c.61.1.1 (B:) Pyrimidine operon regulator PyrR {Bacillus caldolyticus [TaxId: 1394]} mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas vpvgelditlyrvpfpvternvilvddvlftgrtvraamdavmdlgrpariqlavlvdrg hrelpiradfvgknvptsrselivvelsevdgidqvsihek
Timeline for d1nonb_: