Lineage for d1j9cl2 (1j9c L:87-142)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258095Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2258104Protein Coagulation factor VIIa [57201] (1 species)
  7. 2258105Species Human (Homo sapiens) [TaxId:9606] [57202] (96 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 2258223Domain d1j9cl2: 1j9c L:87-142 [103843]
    Other proteins in same PDB: d1j9ch_, d1j9ct1, d1j9ct2
    complexed with 0z6, ca, ful, glc, nag

Details for d1j9cl2

PDB Entry: 1j9c (more details), 2.9 Å

PDB Description: crystal structure of tissue factor-factor viia complex
PDB Compounds: (L:) factor VIIa light chain

SCOPe Domain Sequences for d1j9cl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j9cl2 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

SCOPe Domain Coordinates for d1j9cl2:

Click to download the PDB-style file with coordinates for d1j9cl2.
(The format of our PDB-style files is described here.)

Timeline for d1j9cl2: