Lineage for d1j3ta_ (1j3t A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461193Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 461236Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 461237Family b.34.2.1: SH3-domain [50045] (35 proteins)
  6. 461417Protein Intersectin 2 (KIAA1256) [101669] (1 species)
  7. 461418Species Human (Homo sapiens) [TaxId:9606] [101670] (5 PDB entries)
  8. 461419Domain d1j3ta_: 1j3t A: [103839]
    second SH3 domain

Details for d1j3ta_

PDB Entry: 1j3t (more details)

PDB Description: solution structure of the second sh3 domain of human intersectin 2 (kiaa1256)

SCOP Domain Sequences for d1j3ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens)}
gssgssgvenlkaqalcswtakkdnhlnfskhdiitvleqqenwwfgevhggrgwfpksy
vkiipgsesgpssg

SCOP Domain Coordinates for d1j3ta_:

Click to download the PDB-style file with coordinates for d1j3ta_.
(The format of our PDB-style files is described here.)

Timeline for d1j3ta_: