Lineage for d1j3ta1 (1j3t A:8-68)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783132Protein Intersectin 2 (KIAA1256) [101669] (1 species)
  7. 2783133Species Human (Homo sapiens) [TaxId:9606] [101670] (5 PDB entries)
    Uniprot Q9NZM3 761-841, 897-957, 982-1037, 1055-1121, 1102-1186
  8. 2783134Domain d1j3ta1: 1j3t A:8-68 [103839]
    Other proteins in same PDB: d1j3ta2, d1j3ta3
    structural genomics; second SH3 domain

Details for d1j3ta1

PDB Entry: 1j3t (more details)

PDB Description: solution structure of the second sh3 domain of human intersectin 2 (kiaa1256)
PDB Compounds: (A:) Intersectin 2

SCOPe Domain Sequences for d1j3ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3ta1 b.34.2.1 (A:8-68) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]}
venlkaqalcswtakkdnhlnfskhdiitvleqqenwwfgevhggrgwfpksyvkiipgs
e

SCOPe Domain Coordinates for d1j3ta1:

Click to download the PDB-style file with coordinates for d1j3ta1.
(The format of our PDB-style files is described here.)

Timeline for d1j3ta1: