Lineage for d1j3ea1 (1j3e A:6-116)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564533Fold d.228: Replication modulator SeqA, C-terminal DNA-binding domain [82807] (1 superfamily)
    consists of seven alpha-helices and three-stranded beta-sheet
  4. 2564534Superfamily d.228.1: Replication modulator SeqA, C-terminal DNA-binding domain [82808] (1 family) (S)
    automatically mapped to Pfam PF03925
  5. 2564535Family d.228.1.1: Replication modulator SeqA, C-terminal DNA-binding domain [82809] (2 proteins)
  6. 2564536Protein Replication modulator SeqA, C-terminal DNA-binding domain [82810] (1 species)
    binds to fully methylated and hemimethylated GATC sequences at oriC
  7. 2564537Species Escherichia coli [TaxId:562] [82811] (3 PDB entries)
    Uniprot P36658 71-181
  8. 2564538Domain d1j3ea1: 1j3e A:6-116 [103834]
    Other proteins in same PDB: d1j3ea2
    protein/DNA complex

Details for d1j3ea1

PDB Entry: 1j3e (more details), 2.5 Å

PDB Description: Crystal Structure of the E.coli SeqA protein complexed with N6-methyladenine- guanine mismatch DNA
PDB Compounds: (A:) SeqA protein

SCOPe Domain Sequences for d1j3ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3ea1 d.228.1.1 (A:6-116) Replication modulator SeqA, C-terminal DNA-binding domain {Escherichia coli [TaxId: 562]}
amrelllsdeyaeqkravnrfmlllstlysldaqafaeateslhgrtrvyfaadeqtllk
ngnqtkpkhvpgtpywvitntntgrkcsmiehimqsmqfpaeliekvcgti

SCOPe Domain Coordinates for d1j3ea1:

Click to download the PDB-style file with coordinates for d1j3ea1.
(The format of our PDB-style files is described here.)

Timeline for d1j3ea1: