Lineage for d1j3ea_ (1j3e A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516476Fold d.228: Replication modulator SeqA, C-terminal DNA-binding domain [82807] (1 superfamily)
    consists of seven alpha-helices and three-stranded beta-sheet
  4. 516477Superfamily d.228.1: Replication modulator SeqA, C-terminal DNA-binding domain [82808] (1 family) (S)
  5. 516478Family d.228.1.1: Replication modulator SeqA, C-terminal DNA-binding domain [82809] (1 protein)
  6. 516479Protein Replication modulator SeqA, C-terminal DNA-binding domain [82810] (1 species)
    binds to fully methylated and hemimethylated GATC sequences at oriC
  7. 516480Species Escherichia coli [TaxId:562] [82811] (3 PDB entries)
  8. 516481Domain d1j3ea_: 1j3e A: [103834]

Details for d1j3ea_

PDB Entry: 1j3e (more details), 2.5 Å

PDB Description: Crystal Structure of the E.coli SeqA protein complexed with N6-methyladenine- guanine mismatch DNA
PDB Compounds: (A:)

SCOP Domain Sequences for d1j3ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3ea_ d.228.1.1 (A:) Replication modulator SeqA, C-terminal DNA-binding domain {Escherichia coli}
plgsamrelllsdeyaeqkravnrfmlllstlysldaqafaeateslhgrtrvyfaadeq
tllkngnqtkpkhvpgtpywvitntntgrkcsmiehimqsmqfpaeliekvcgti

SCOP Domain Coordinates for d1j3ea_:

Click to download the PDB-style file with coordinates for d1j3ea_.
(The format of our PDB-style files is described here.)

Timeline for d1j3ea_: