Lineage for d1vk3a2 (1vk3 A:346-507)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201987Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 2201988Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)
  6. 2202015Protein Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 [103082] (1 species)
    duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
  7. 2202016Species Thermotoga maritima [TaxId:2336] [103083] (7 PDB entries)
    TM1246
  8. 2202018Domain d1vk3a2: 1vk3 A:346-507 [100847]
    Other proteins in same PDB: d1vk3a3, d1vk3a4
    structural genomics
    complexed with cl

Details for d1vk3a2

PDB Entry: 1vk3 (more details), 2.15 Å

PDB Description: Crystal structure of Phosphoribosylformylglycinamidine synthase II (TM1246) from Thermotoga maritima at 2.15 A resolution
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOPe Domain Sequences for d1vk3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vk3a2 d.79.4.1 (A:346-507) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]}
veytpgkipefkrvefeevnarevfeqydhmvgtdtvvppgfgaavmrikrdggyslvth
sradlalqdtywgtliavlesvrktlsvgaeplaitncvnygdpdvdpvglsammtalkn
acefsgvpvasgnaslyntyqgkpipptlvvgmlgkvnpqkv

SCOPe Domain Coordinates for d1vk3a2:

Click to download the PDB-style file with coordinates for d1vk3a2.
(The format of our PDB-style files is described here.)

Timeline for d1vk3a2: