Lineage for d1viva_ (1viv A:)
- Root: SCOP 1.67
Class c: Alpha and beta proteins (a/b) [51349] (130 folds) 
Fold c.80: SIS domain [53696] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345Superfamily c.80.1: SIS domain [53697] (3 families) 
Family c.80.1.3: mono-SIS domain [69599] (4 proteins)
dimer of mono-domain subunits
Protein Hypothetical protein YckF [82534] (1 species) Species Bacillus subtilis [TaxId:1423] [82535] (2 PDB entries) 
Domain d1viva_: 1viv A: [100775]
Details for d1viva_
PDB Entry: 1viv (more details), 2.6 Å
PDB Description: crystal structure of a hypothetical protein
SCOP Domain Sequences for d1viva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1viva_ c.80.1.3 (A:) Hypothetical protein YckF {Bacillus subtilis}
lktteyvaeilnelhnsaayisneeadqladhilsshqiftagagrsglmaksfamrlmh
mgfnahivgeiltpplaegdlviigsgsgetkslihtaakakslhgivaaltinpessig
kqadliirmpgspkdqsngsyktiqpmgslfeqtlllfydavilklmekkgldsetmfth
hanl
SCOP Domain Coordinates for d1viva_:
Click to download the PDB-style file with coordinates for d1viva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1viva_:
- d1viva_ is new in SCOP 1.67
- d1viva_ appears in SCOP 1.69
- d1viva_ appears in the current release, SCOPe 2.08, called d1viva1
View in 3D
