Lineage for d1vivb_ (1viv B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 402385Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 402386Superfamily c.80.1: SIS domain [53697] (3 families) (S)
  5. 402437Family c.80.1.3: mono-SIS domain [69599] (4 proteins)
    dimer of mono-domain subunits
  6. 402447Protein Hypothetical protein YckF [82534] (1 species)
  7. 402448Species Bacillus subtilis [TaxId:1423] [82535] (2 PDB entries)
  8. 402452Domain d1vivb_: 1viv B: [100776]
    structural genomics

Details for d1vivb_

PDB Entry: 1viv (more details), 2.6 Å

PDB Description: crystal structure of a hypothetical protein

SCOP Domain Sequences for d1vivb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vivb_ c.80.1.3 (B:) Hypothetical protein YckF {Bacillus subtilis}
lktteyvaeilnelhnsaayisneeadqladhilsshqiftagagrsglmaksfamrlmh
mgfnahivgeiltpplaegdlviigsgsgetkslihtaakakslhgivaaltinpessig
kqadliirmpgspkdqsngsyktiqpmgslfeqtlllfydavilklmekkgldsetm

SCOP Domain Coordinates for d1vivb_:

Click to download the PDB-style file with coordinates for d1vivb_.
(The format of our PDB-style files is described here.)

Timeline for d1vivb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1viva_