SCOP 1.67: Domain d1vivb_: 1viv B:

Lineage for d1vivb_ (1viv B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (3 families)

5. Family c.80.1.3: mono-SIS domain [69599] (4 proteins)
   dimer of mono-domain subunits

6. Protein Hypothetical protein YckF [82534] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [82535] (2 PDB entries)

8. Domain d1vivb_: 1viv B: [100776]
   structural genomics

Details for d1vivb_

PDB Entry: 1viv, 2.6 Å

PDB Description: crystal structure of a hypothetical protein

SCOP Domain Sequences for d1vivb_:

Sequence; same for both SEQRES and ATOM records:

>d1vivb_ c.80.1.3 (B:) Hypothetical protein YckF {Bacillus subtilis}
lktteyvaeilnelhnsaayisneeadqladhilsshqiftagagrsglmaksfamrlmh
mgfnahivgeiltpplaegdlviigsgsgetkslihtaakakslhgivaaltinpessig
kqadliirmpgspkdqsngsyktiqpmgslfeqtlllfydavilklmekkgldsetm

Timeline for d1vivb_:

• d1vivb_ is new in SCOP 1.67
  
• d1vivb_ appears in SCOP 1.69
  
• d1vivb_ appears in the current release, SCOPe 2.08, called d1vivb1