SCOPe 2.06: Domain d1vioa2: 1vio A:2-57

Lineage for d1vioa2 (1vio A:2-57)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
   alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta

4. Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families)
   common motif in otherwise different folds

5. Family d.66.1.5: Pseudouridine synthase RsuA N-terminal domain [75468] (1 protein)
   automatically mapped to Pfam PF01479

6. Protein Pseudouridine synthase RsuA N-terminal domain [75469] (2 species)

7. Species Haemophilus influenzae [TaxId:727] [103049] (1 PDB entry)

8. Domain d1vioa2: 1vio A:2-57 [100763]
   Other proteins in same PDB: d1vioa1, d1vioa3, d1viob1, d1viob3
   structural genomics
   complexed with bu1

Details for d1vioa2

PDB Entry: 1vio, 1.59 Å

PDB Description: crystal structure of pseudouridylate synthase

PDB Compounds: (A:) ribosomal small subunit pseudouridine synthase a

SCOPe Domain Sequences for d1vioa2:

Sequence; same for both SEQRES and ATOM records:

>d1vioa2 d.66.1.5 (A:2-57) Pseudouridine synthase RsuA N-terminal domain {Haemophilus influenzae [TaxId: 727]}
rldkfiaenvgltrsqatkairqsavkingeivksgsvqisqedeiyfedelltwi

Timeline for d1vioa2:

• d1vioa2 first appeared in SCOP 1.67
  
• d1vioa2 appears in SCOPe 2.05
  
• d1vioa2 appears in SCOPe 2.07
  
• d1vioa2 appears in the current release, SCOPe 2.08