![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
![]() | Superfamily c.80.1: SIS domain [53697] (4 families) ![]() |
![]() | Family c.80.1.3: mono-SIS domain [69599] (6 proteins) dimer of mono-domain subunits |
![]() | Protein Hypothetical protein AF1796 [102670] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [102671] (1 PDB entry) |
![]() | Domain d1vima_: 1vim A: [100758] structural genomics complexed with fmt |
PDB Entry: 1vim (more details), 1.36 Å
SCOPe Domain Sequences for d1vima_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vima_ c.80.1.3 (A:) Hypothetical protein AF1796 {Archaeoglobus fulgidus [TaxId: 2234]} hgghmsllrflevvsehiknlrnhidletvgemiklidsarsifvigagrsgyiakafam rlmhlgytvyvvgetvtpritdqdvlvgisgsgettsvvniskkakdigsklvavtgkrd sslakmadvvmvvkgkmkqerdeilsqlaplgtmfeltamifldalvaeimmqkhltekd learhavleegg
Timeline for d1vima_: