Lineage for d1vima_ (1vim A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1006340Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 1006341Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 1006456Family c.80.1.3: mono-SIS domain [69599] (6 proteins)
    dimer of mono-domain subunits
  6. 1006457Protein Hypothetical protein AF1796 [102670] (1 species)
  7. 1006458Species Archaeoglobus fulgidus [TaxId:2234] [102671] (1 PDB entry)
  8. 1006459Domain d1vima_: 1vim A: [100758]
    structural genomics
    complexed with fmt

Details for d1vima_

PDB Entry: 1vim (more details), 1.36 Å

PDB Description: crystal structure of an hypothetical protein
PDB Compounds: (A:) Hypothetical protein AF1796

SCOPe Domain Sequences for d1vima_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vima_ c.80.1.3 (A:) Hypothetical protein AF1796 {Archaeoglobus fulgidus [TaxId: 2234]}
hgghmsllrflevvsehiknlrnhidletvgemiklidsarsifvigagrsgyiakafam
rlmhlgytvyvvgetvtpritdqdvlvgisgsgettsvvniskkakdigsklvavtgkrd
sslakmadvvmvvkgkmkqerdeilsqlaplgtmfeltamifldalvaeimmqkhltekd
learhavleegg

SCOPe Domain Coordinates for d1vima_:

Click to download the PDB-style file with coordinates for d1vima_.
(The format of our PDB-style files is described here.)

Timeline for d1vima_: