Lineage for d1vhya2 (1vhy A:74-247)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1188485Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 1188486Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 1188563Family c.116.1.5: YggJ C-terminal domain-like [89632] (3 proteins)
    contains extra strand (3) in the parallel beta-sheet, order 321546; similar dimerisation to the MTH1 domain
  6. 1188564Protein Hypothetical protein HI0303 [89633] (1 species)
  7. 1188565Species Haemophilus influenzae [TaxId:727] [89634] (2 PDB entries)
  8. 1188566Domain d1vhya2: 1vhy A:74-247 [100715]
    Other proteins in same PDB: d1vhya1, d1vhyb1
    structural genomics

Details for d1vhya2

PDB Entry: 1vhy (more details), 1.9 Å

PDB Description: crystal structure of haemophilus influenzae protein hi0303, pfam duf558
PDB Compounds: (A:) Hypothetical protein HI0303

SCOPe Domain Sequences for d1vhya2:

Sequence, based on SEQRES records: (download)

>d1vhya2 c.116.1.5 (A:74-247) Hypothetical protein HI0303 {Haemophilus influenzae [TaxId: 727]}
keshlkihlgqvisrgermeftiqksvelgvnvitplwsercgvkldaermdkkiqqwqk
iaiaaceqcgrnivpeirplmklqdwcaendgalklnlhprahysiktlptipaggvrll
igsegglsaqeiaqteqqgfteillgkrvlrtetaslaaisalqicfgdlgeeg

Sequence, based on observed residues (ATOM records): (download)

>d1vhya2 c.116.1.5 (A:74-247) Hypothetical protein HI0303 {Haemophilus influenzae [TaxId: 727]}
keshlkihlgqvirmeftiqksvelgvnvitplwsercgvkldaermdkkiqqwqkiaia
aceqcgrnivpeirplmklqdwcaendgalklnlhprahysiktlptipaggvrlligse
gglsaqeiaqteqqgfteillgkrvlrtetaslaaisalqicfgdlgeeg

SCOPe Domain Coordinates for d1vhya2:

Click to download the PDB-style file with coordinates for d1vhya2.
(The format of our PDB-style files is described here.)

Timeline for d1vhya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vhya1