SCOP 1.75: Domain d1vhwe_: 1vhw E:

Lineage for d1vhwe_ (1vhw E:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (9 species)

7. Species Vibrio cholerae [TaxId:666] [102499] (2 PDB entries)

8. Domain d1vhwe_: 1vhw E: [100710]
   structural genomics

Details for d1vhwe_

PDB Entry: 1vhw, 1.54 Å

PDB Description: crystal structure of purine nucleoside phosphorylase with adenosine

PDB Compounds: (E:) purine nucleoside phosphorylase

SCOP Domain Sequences for d1vhwe_:

Sequence; same for both SEQRES and ATOM records:

>d1vhwe_ c.56.2.1 (E:) Purine nucleoside phosphorylase, PNP {Vibrio cholerae [TaxId: 666]}
tphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrrisvmg
hgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirfk
dhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgveme
aagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq

Timeline for d1vhwe_:

• d1vhwe_ first appeared in SCOP 1.67
  
• d1vhwe_ appears in SCOP 1.73
  
• d1vhwe_ appears in SCOPe 2.01
  
• d1vhwe_ appears in the current release, SCOPe 2.08