SCOPe 2.04: Domain d1vhvb_: 1vhv B:

Lineage for d1vhvb_ (1vhv B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 5 strands, order 32415
   Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest

4. Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families)

5. Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
   Pfam PF00590

6. Protein Diphthine synthase, DphB [102684] (3 species)
   diphthamide biosynthesis methyltransferase

7. Species Archaeoglobus fulgidus [TaxId:2234] [102685] (1 PDB entry)

8. Domain d1vhvb_: 1vhv B: [100705]

Details for d1vhvb_

PDB Entry: 1vhv, 1.75 Å

PDB Description: crystal structure of diphthine synthase

PDB Compounds: (B:) diphthine synthase

SCOPe Domain Sequences for d1vhvb_:

Sequence; same for both SEQRES and ATOM records:

>d1vhvb_ c.90.1.1 (B:) Diphthine synthase, DphB {Archaeoglobus fulgidus [TaxId: 2234]}
slltfvglglwdvkdisvkgleavreadevyveyytskllssieemeeffgkrvvelers
dleensfrlieraksksvvllvpgdpmvatthsaikleaerkgvktriihgasistavcg
ltglhnyrfgksatvswhrsqtpvnvikanrsidahtllfldlhpepmtighavenliae
daqmkdlyavgiaragsgeevvkcdrlenlkkidfgkplhvmvvlaktlhfmefeclref
adapaelerlva

Timeline for d1vhvb_:

• d1vhvb_ first appeared in SCOP 1.67
  
• d1vhvb_ appears in SCOPe 2.03
  
• d1vhvb_ appears in SCOPe 2.05
  
• d1vhvb_ appears in the current release, SCOPe 2.08, called d1vhvb1