SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1vh9b1 (1vh9 B:2-137)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2167645Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2167646Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2167937Family d.38.1.5: PaaI/YdiI-like [89902] (15 protein domains)
  6. 2167989Protein Hypothetical protein YbdB [102912] (1 species)
  7. 2167990Species Escherichia coli [TaxId:562] [102913] (1 PDB entry)
  8. 2167992Domain d1vh9b1: 1vh9 B:2-137 [100654]
    Other proteins in same PDB: d1vh9a2, d1vh9b2
    structural genomics

Details for d1vh9b1

PDB Entry: 1vh9 (more details), 2.15 Å

PDB Description: Crystal structure of a putative thioesterase
PDB Compounds: (B:) Hypothetical protein ybdB

SCOPe Domain Sequences for d1vh9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vh9b1 d.38.1.5 (B:2-137) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]}
iwkrhltldelnatsdntmvahlgivytrlgddvleaempvdtrthqpfgllhggasaal
aetlgsmagfmmtrdgqcvvgtelnathhrpvsegkvrgvcqplhlgrqnqsweivvfde
qgrrcctcrlgtavlg

SCOPe Domain Coordinates for d1vh9b1:

Click to download the PDB-style file with coordinates for d1vh9b1.
(The format of our PDB-style files is described here.)

Timeline for d1vh9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vh9b2