SCOPe 2.03: Domain d1vh7a_: 1vh7 A:

Lineage for d1vh7a_ (1vh7 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
   structural evidence for the gene duplication within the barrel fold
   automatically mapped to Pfam PF00977

6. Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species)

7. Species Thermotoga maritima [TaxId:2336] [51371] (4 PDB entries)

8. Domain d1vh7a_: 1vh7 A: [100646]
   structural genomics
   complexed with po4

Details for d1vh7a_

PDB Entry: 1vh7, 1.9 Å

PDB Description: Crystal structure of a cyclase subunit of imidazolglycerolphosphate synthase

PDB Compounds: (A:) Imidazole glycerol phosphate synthase subunit hisF

SCOPe Domain Sequences for d1vh7a_:

Sequence; same for both SEQRES and ATOM records:

>d1vh7a_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
lakriiacldvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrkt
mlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtfg
sqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtksg
ydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkeyl
kkhgvnvrle

Timeline for d1vh7a_:

• d1vh7a_ first appeared in SCOP 1.67
  
• d1vh7a_ appears in SCOPe 2.02
  
• d1vh7a_ appears in SCOPe 2.04
  
• d1vh7a_ appears in the current release, SCOPe 2.08