Lineage for d1vh7a_ (1vh7 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 383803Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 383804Family c.1.2.1: Histidine biosynthesis enzymes [51367] (2 proteins)
    structural evidence for the gene duplication within the barrel fold
  6. 383805Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species)
  7. 383818Species Thermotoga maritima [TaxId:243274] [51371] (3 PDB entries)
  8. 383820Domain d1vh7a_: 1vh7 A: [100646]
    structural genomics
    complexed with po4

Details for d1vh7a_

PDB Entry: 1vh7 (more details), 1.9 Å

PDB Description: Crystal structure of a cyclase subunit of imidazolglycerolphosphate synthase

SCOP Domain Sequences for d1vh7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vh7a_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima}
lakriiacldvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrkt
mlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtfg
sqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtksg
ydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkeyl
kkhgvnvrle

SCOP Domain Coordinates for d1vh7a_:

Click to download the PDB-style file with coordinates for d1vh7a_.
(The format of our PDB-style files is described here.)

Timeline for d1vh7a_: