SCOPe 2.06: Domain d1v6jb_: 1v6j B:

Lineage for d1v6jb_ (1v6j B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (24 PDB entries)
   Uniprot P02872 24-255

8. Domain d1v6jb_: 1v6j B: [100388]
   complexed with ca, mn

Details for d1v6jb_

PDB Entry: 1v6j, 2.9 Å

PDB Description: peanut lectin-lactose complex crystallized in orthorhombic form at acidic ph

PDB Compounds: (B:) Galactose-binding lectin

SCOPe Domain Sequences for d1v6jb_:

Sequence; same for both SEQRES and ATOM records:

>d1v6jb_ b.29.1.1 (B:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

Timeline for d1v6jb_:

• d1v6jb_ first appeared in SCOP 1.67
  
• d1v6jb_ appears in SCOPe 2.05
  
• d1v6jb_ appears in SCOPe 2.07
  
• d1v6jb_ appears in the current release, SCOPe 2.08