Lineage for d1v55t_ (1v55 T:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1059440Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
  5. 1059441Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)
  6. 1059442Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 1059443Species Cow (Bos taurus) [TaxId:9913] [81408] (22 PDB entries)
  8. 1059455Domain d1v55t_: 1v55 T: [100370]
    Other proteins in same PDB: d1v55a_, d1v55b1, d1v55b2, d1v55c_, d1v55d_, d1v55e_, d1v55f_, d1v55h_, d1v55i_, d1v55j_, d1v55k_, d1v55l_, d1v55m_, d1v55n_, d1v55o1, d1v55o2, d1v55p_, d1v55q_, d1v55r_, d1v55s_, d1v55u_, d1v55v_, d1v55w_, d1v55x_, d1v55y_, d1v55z_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d1v55t_

PDB Entry: 1v55 (more details), 1.9 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully reduced state
PDB Compounds: (T:) Cytochrome c oxidase polypeptide VIa-heart

SCOPe Domain Sequences for d1v55t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v55t_ f.23.2.1 (T:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOPe Domain Coordinates for d1v55t_:

Click to download the PDB-style file with coordinates for d1v55t_.
(The format of our PDB-style files is described here.)

Timeline for d1v55t_: