Lineage for d1v55r_ (1v55 R:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 776040Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 776041Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 776042Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 776043Species Cow (Bos taurus) [TaxId:9913] [48482] (14 PDB entries)
  8. 776049Domain d1v55r_: 1v55 R: [100368]
    Other proteins in same PDB: d1v55a_, d1v55b1, d1v55b2, d1v55c_, d1v55d_, d1v55f_, d1v55g_, d1v55h_, d1v55i_, d1v55j_, d1v55k_, d1v55l_, d1v55m_, d1v55n_, d1v55o1, d1v55o2, d1v55p_, d1v55q_, d1v55s_, d1v55t_, d1v55u_, d1v55v_, d1v55w_, d1v55x_, d1v55y_, d1v55z_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d1v55r_

PDB Entry: 1v55 (more details), 1.9 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully reduced state
PDB Compounds: (R:) Cytochrome c oxidase polypeptide Va

SCOP Domain Sequences for d1v55r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v55r_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOP Domain Coordinates for d1v55r_:

Click to download the PDB-style file with coordinates for d1v55r_.
(The format of our PDB-style files is described here.)

Timeline for d1v55r_: