Lineage for d1v55k_ (1v55 K:)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887257Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
  5. 887258Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (1 protein)
  6. 887259Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 887260Species Cow (Bos taurus) [TaxId:9913] [81420] (14 PDB entries)
  8. 887265Domain d1v55k_: 1v55 K: [100360]
    Other proteins in same PDB: d1v55a_, d1v55b1, d1v55b2, d1v55c_, d1v55d_, d1v55e_, d1v55f_, d1v55g_, d1v55h_, d1v55i_, d1v55j_, d1v55l_, d1v55m_, d1v55n_, d1v55o1, d1v55o2, d1v55p_, d1v55q_, d1v55r_, d1v55s_, d1v55t_, d1v55u_, d1v55v_, d1v55w_, d1v55y_, d1v55z_

Details for d1v55k_

PDB Entry: 1v55 (more details), 1.9 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully reduced state
PDB Compounds: (K:) Cytochrome c oxidase polypeptide VIIb

SCOP Domain Sequences for d1v55k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v55k_ f.23.5.1 (K:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOP Domain Coordinates for d1v55k_:

Click to download the PDB-style file with coordinates for d1v55k_.
(The format of our PDB-style files is described here.)

Timeline for d1v55k_: