Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (5 families) has extra strand located between strands 2 and 3 |
Family c.72.1.1: Ribokinase-like [53614] (9 proteins) |
Protein 2-keto-3-deoxygluconate kinase [75295] (2 species) |
Species Thermus thermophilus [TaxId:274] [102640] (4 PDB entries) |
Domain d1v1bd_: 1v1b D: [100254] structural genomics complexed with atp |
PDB Entry: 1v1b (more details), 2.6 Å
SCOP Domain Sequences for d1v1bd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v1bd_ c.72.1.1 (D:) 2-keto-3-deoxygluconate kinase {Thermus thermophilus [TaxId: 274]} mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl l
Timeline for d1v1bd_: