PDB entry 1v1b

View 1v1b on RCSB PDB site
Description: 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound ATP
Class: transferase
Keywords: 2-KETO-3-DEOXYGLUCONATE KINASE, ATP, THERMUS THERMOPHILUS, STRUCTURAL GENOMICS, TRANSFERASE, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-04-13, released 2004-04-14
The last revision prior to the SCOP 1.75 freeze date was dated 2004-07-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.178
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1v1ba_
  • Chain 'B':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1v1bb_
  • Chain 'C':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1v1bc_
  • Chain 'D':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1v1bd_
  • Heterogens: ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v1bA (A:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lkatqtfmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1bA (A:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    l
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v1bB (B:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lkatqtfmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1bB (B:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    l
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v1bC (C:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lkatqtfmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1bC (C:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    l
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v1bD (D:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lkatqtfmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1bD (D:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    l