Class g: Small proteins [56992] (90 folds) |
Fold g.23: TB module/8-cys domain [57580] (1 superfamily) disulfide-rich; alpha+beta |
Superfamily g.23.1: TB module/8-cys domain [57581] (1 family) |
Family g.23.1.1: TB module/8-cys domain [57582] (2 proteins) transforming growth factor beta binding protein-like domain |
Protein Fibrillin [57583] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57584] (5 PDB entries) |
Domain d1uzjb3: 1uzj B:2529-2604 [100228] Other proteins in same PDB: d1uzja1, d1uzja2, d1uzjb1, d1uzjb2, d1uzjc1, d1uzjc2 TB4 complexed with ca |
PDB Entry: 1uzj (more details), 2.25 Å
SCOPe Domain Sequences for d1uzjb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uzjb3 g.23.1.1 (B:2529-2604) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} trsgncyldirprgdngdtacsneigvgvskascccslgkawgtpcemcpavntseykil cpggegfrpnpitvil
Timeline for d1uzjb3: