SCOP 1.67: Domain d1uyzb_: 1uyz B:

Lineage for d1uyzb_ (1uyz B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (21 families)

5. Family b.18.1.10: CBM6 [69213] (3 proteins)

6. Protein Cellulase B (lichenase 5a) [101583] (1 species)

7. Species Cellvibrio mixtus [TaxId:39650] [101584] (6 PDB entries)

8. Domain d1uyzb_: 1uyz B: [100215]
   CBM6-2; complexed with xylotetraose
   complexed with ca, gol, na, xyp

Details for d1uyzb_

PDB Entry: 1uyz, 1.6 Å

PDB Description: carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a in complex with xylotetraose

SCOP Domain Sequences for d1uyzb_:

Sequence; same for both SEQRES and ATOM records:

>d1uyzb_ b.18.1.10 (B:) Cellulase B (lichenase 5a) {Cellvibrio mixtus}
mviatiqaedhsqqsgtqqetttdtgggknvgyidagdwlsyagtpvnipssgsylieyr
vasqngggsltfeeaggapvhgtiaipatggwqtwttiqhtvnlsagshqfgikanaggw
nlnwirinkth

Timeline for d1uyzb_:

• d1uyzb_ is new in SCOP 1.67
  
• d1uyzb_ appears in SCOP 1.69
  
• d1uyzb_ appears in the current release, SCOPe 2.08