| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.10: Family 6 carbohydrate binding module, CBM6 [69213] (4 proteins) |
| Protein Cellulase B (lichenase 5a) [101583] (1 species) |
| Species Cellvibrio mixtus [TaxId:39650] [101584] (6 PDB entries) |
| Domain d1uyzb_: 1uyz B: [100215] CBM6-2; complexed with xylotetraose complexed with ca, gol, na |
PDB Entry: 1uyz (more details), 1.6 Å
SCOPe Domain Sequences for d1uyzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uyzb_ b.18.1.10 (B:) Cellulase B (lichenase 5a) {Cellvibrio mixtus [TaxId: 39650]}
mviatiqaedhsqqsgtqqetttdtgggknvgyidagdwlsyagtpvnipssgsylieyr
vasqngggsltfeeaggapvhgtiaipatggwqtwttiqhtvnlsagshqfgikanaggw
nlnwirinkth
Timeline for d1uyzb_: