Lineage for d1uxmi_ (1uxm I:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 936733Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 936734Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 936747Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 936845Species Human (Homo sapiens) [TaxId:9606] [49333] (55 PDB entries)
  8. 936963Domain d1uxmi_: 1uxm I: [100165]
    complexed with cu, zn; mutant

Details for d1uxmi_

PDB Entry: 1uxm (more details), 1.9 Å

PDB Description: a4v mutant of human sod1
PDB Compounds: (I:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d1uxmi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxmi_ b.1.8.1 (I:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkvvcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

SCOPe Domain Coordinates for d1uxmi_:

Click to download the PDB-style file with coordinates for d1uxmi_.
(The format of our PDB-style files is described here.)

Timeline for d1uxmi_: