Lineage for d1uwnx_ (1uwn X:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1215605Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1215775Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 1215776Family d.110.3.1: PYP-like [55786] (2 proteins)
  6. 1215777Protein Photoactive yellow protein, PYP [55787] (1 species)
  7. 1215778Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [55788] (49 PDB entries)
    Uniprot P16113
  8. 1215788Domain d1uwnx_: 1uwn X: [100127]
    complexed with hc4, so4

Details for d1uwnx_

PDB Entry: 1uwn (more details), 1.2 Å

PDB Description: the initial events in the photocycle of photoactive yellow protein: a common mechanism on light activation in photoreceptor proteins
PDB Compounds: (X:) Photoactive yellow protein

SCOPe Domain Sequences for d1uwnx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwnx_ d.110.3.1 (X:) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

SCOPe Domain Coordinates for d1uwnx_:

Click to download the PDB-style file with coordinates for d1uwnx_.
(The format of our PDB-style files is described here.)

Timeline for d1uwnx_: