Lineage for d1uvqa2 (1uvq A:2-84)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1021292Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1021298Species Human (Homo sapiens), HLA-DQ6 [TaxId:9606] [102834] (1 PDB entry)
  8. 1021299Domain d1uvqa2: 1uvq A:2-84 [100063]
    Other proteins in same PDB: d1uvqa1, d1uvqb1, d1uvqb2
    complexed with a hypocretin peptide
    complexed with acy, gly, nag, zn

Details for d1uvqa2

PDB Entry: 1uvq (more details), 1.8 Å

PDB Description: crystal structure of hla-dq0602 in complex with a hypocretin peptide
PDB Compounds: (A:) hla class II histocompatibility antigen

SCOPe Domain Sequences for d1uvqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uvqa2 d.19.1.1 (A:2-84) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DQ6 [TaxId: 9606]}
divadhvascgvnlyqfygpsgqythefdgdeqfyvdlerketawrwpefskfggfdpqg
alrnmavakhnlnimikrynsta

SCOPe Domain Coordinates for d1uvqa2:

Click to download the PDB-style file with coordinates for d1uvqa2.
(The format of our PDB-style files is described here.)

Timeline for d1uvqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uvqa1