Lineage for d6p57b_ (6p57 B:)
- Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds) 
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
disulfide-rich fold; common core is all-betaSuperfamily g.17.1: Cystine-knot cytokines [57501] (8 families) 
Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins) 
Protein automated matches [194842] (2 species)
not a true protein
Species Cow (Bos taurus) [TaxId:9913] [378075] (1 PDB entry) 
Domain d6p57b_: 6p57 B: [378077]
automated match to d1qfwb_
complexed with bog, man
Details for d6p57b_
PDB Entry: 6p57 (more details), 3.16 Å
PDB Description: crystal structure of the beta subunit of luteinizing hormone
PDB Compounds: (B:) Lutropin subunit betaSCOPe Domain Sequences for d6p57b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6p57b_ g.17.1.4 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
srgplrplcqpinatlaaekeacpvcitfttsicagycpsmkrvlpvilppmpqrvctyh
elrfasvrlpgcppgvdpmvsfpvalschcgpcrlsstdcggprtqplacdhpplpdi
SCOPe Domain Coordinates for d6p57b_:
Click to download the PDB-style file with coordinates for d6p57b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6p57b_:
- d6p57b_ first appeared in SCOPe 2.07
View in 3D
