Lineage for d6p57b_ (6p57 B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033866Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins)
  6. 3033896Protein automated matches [194842] (2 species)
    not a true protein
  7. 3033897Species Cow (Bos taurus) [TaxId:9913] [378075] (1 PDB entry)
  8. 3033899Domain d6p57b_: 6p57 B: [378077]
    automated match to d1qfwb_
    complexed with bog, man

Details for d6p57b_

PDB Entry: 6p57 (more details), 3.16 Å

PDB Description: crystal structure of the beta subunit of luteinizing hormone
PDB Compounds: (B:) Lutropin subunit beta

SCOPe Domain Sequences for d6p57b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6p57b_ g.17.1.4 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
srgplrplcqpinatlaaekeacpvcitfttsicagycpsmkrvlpvilppmpqrvctyh
elrfasvrlpgcppgvdpmvsfpvalschcgpcrlsstdcggprtqplacdhpplpdi

SCOPe Domain Coordinates for d6p57b_:

Click to download the PDB-style file with coordinates for d6p57b_.
(The format of our PDB-style files is described here.)

Timeline for d6p57b_: