Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins) contains many insertions in the common fold automatically mapped to Pfam PF00840 |
Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (8 species) |
Species Trichoderma reesei, Cel7A [TaxId:51453] [68898] (22 PDB entries) |
Domain d6cela_: 6cel A: [24279] complexed with co, nag |
PDB Entry: 6cel (more details), 1.7 Å
SCOPe Domain Sequences for d6cela_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cela_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Cel7A [TaxId: 51453]} esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl kfingqanvegwepssnnantgigghgsccsqmdiweansisealtphpcttvgqeiceg dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn ikfgpigstgnpsg
Timeline for d6cela_: