PDB entry 6cel

View 6cel on RCSB PDB site
Description: cbh1 (e212q) cellopentaose complex
Class: hydrolase
Keywords: hydrolase, cellulose degradation, glycosidase, glycoprotein, glycosylated protein
Deposited on 1997-09-24, released 1997-12-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,4-beta-d-glucan cellobiohydrolase I
    Species: Hypocrea jecorina [TaxId:51453]
    Gene: CBH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00725 (1-433)
      • cloning artifact (93)
      • engineered (211)
    Domains in SCOPe 2.08: d6cela_
  • Heterogens: NAG, CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6celA (A:)
    esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
    cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
    tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
    kfingqanvegwepssnnantgigghgsccsqmdiweansisealtphpcttvgqeiceg
    dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
    nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
    vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
    ikfgpigstgnpsg